SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029722 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029722
Domain Number 1 Region: 65-249
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.08e-79
Family T-box 0.000000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029722   Gene: ENSMMUG00000022580   Transcript: ENSMMUT00000031768
Sequence length 544
Comment pep:known_by_projection chromosome:MMUL_1:16:45006549:45034062:-1 gene:ENSMMUG00000022580 transcript:ENSMMUT00000031768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQDKGLSESEEAFRAPGPVLGEASAANAPEPALAAPGLSGAALGSTPGPGADVAAAAAE
QTIENIKVGLHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYILLIDIVP
ADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPF
GHIILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFPETSFISVTSYQNHKITQLKIE
NNPFAKGFRGSDDSDLRVARLQSKEYPVISKSIMRQRLISPQLSATPDVGPLLGTHQALQ
HYQHENGAHSQLAEPQDLPLSTFPAQRDSSLFYHCLKRRDGARHLDLPCKRSYLEAPSSV
GEDHYFRSPPPYDQQMLSPSYCSEVTPREACMYSGSGPEIAGVSGVDDLPPPPLSCNMWT
SVSPYTSYSVQTMETVPYQPFPTHFTATTMMPRLPTLSAQSSQPPGNAHFSVYNQLSQSQ
VRERGPSASFARERGLPPGCERKPPSPHLNAANEFLYSQTFSLSRESSLQYHSGMGTVEN
WTDG
Download sequence
Identical sequences A0A2K6BSW5 F6ZEH2
XP_011731425.1.29376 XP_014975506.1.72884 XP_015293874.1.63531 9544.ENSMMUP00000029722 ENSMMUP00000029722 ENSMMUP00000029722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]