SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029746 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029746
Domain Number 1 Region: 483-687
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.73e-35
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 699-887
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-33
Family Laminin G-like module 0.008
Further Details:      
 
Domain Number 3 Region: 289-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.7e-32
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 4 Region: 25-184
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.9e-30
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 5 Region: 1103-1243,1272-1314
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-29
Family Laminin G-like module 0.000000908
Further Details:      
 
Domain Number 6 Region: 920-1091
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-20
Family Laminin G-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029746
Domain Number - Region: 211-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000332
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029746   Gene: ENSMMUG00000022595   Transcript: ENSMMUT00000031794
Sequence length 1710
Comment pep:known_by_projection chromosome:MMUL_1:14:9744666:9852135:1 gene:ENSMMUG00000022595 transcript:ENSMMUT00000031794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGSRWRLPPPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRT
NATRALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTR
DARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLL
ANLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGK
FCSEEEHPMEGPAHLTLNSEVGSLLFSEGGAGRGGAGDVHQSTKGKEEFVATFKGNEFFC
YDLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEA
LVEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYT
MLGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQ
GDLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRQAG
GGAGSHSSAQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRK
GSISVNSRSTPFLATGDSEILDLESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVR
DLFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGICREGWNRFVCDCIGT
GFLGRVCEREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESAD
TLRLELDGGQMKLTVNLDCLRVGCAPSKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSV
DNVTVEGQMAGAHTRLEFHNIETGIMTERRFISVVPSKFIGHLSGVVSRPRPLMGFSCST
RATAMTSLSSSCTPSSTLLTPELLPCQSSQLYLFSVHCHLLYRQKSRTLLAHKPLPSSSS
SELVSQEPAPWYIHYVFDLGNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRT
VTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIADA
LHRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYIFG
KGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGV
IFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAI
ARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLA
LAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRGRS
PTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGGELILPIITEDSLDPPPVATRSPF
VPPPPTFYPFLTGVGATQDTLPPPAARRPPSGGPCQAERDDSDCEEPIEASGFASGEVFD
SSLPPTDDEDFYTTFPLVTDRTTFLSPRKPAPRPNLRTDGATGAPGVLFAPSAPAPNLPA
GKMNHRDPLQPLLENPPLGPGAPTSFEPRRPPPLRPGVTSAPGFPHLPTANPTGPGERGP
PGAVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYISNSAQ
SNGAVVKEKAPTAPKTPSKAKKNKDKEYYV
Download sequence
Identical sequences ENSMMUP00000029746 ENSMMUP00000029746 9544.ENSMMUP00000029746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]