SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029747 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029747
Domain Number 1 Region: 404-580
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.32e-75
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000154
Further Details:      
 
Domain Number 2 Region: 581-698
Classification Level Classification E-value
Superfamily E set domains 2.4e-31
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029747   Gene: ENSMMUG00000022596   Transcript: ENSMMUT00000031795
Sequence length 930
Comment pep:known chromosome:MMUL_1:18:72704502:72827628:1 gene:ENSMMUG00000022596 transcript:ENSMMUT00000031795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGLEDQEFDFEFLFEFNQRDEGAAAAAPEHYGYASSNVSPALPLPTAHSTLPAPCHNLQ
TSTPGIVQPADHPSGYGAAMDGGPTGYFLSSGHARPDGAPALESPRIEITSCLGLYHNNN
QFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNY
SYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLG
ARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIV
AAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDFSS
FQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPASYMSPTLPALDWQLPSHSGPYELRIEVQ
PKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLESEPLMLQLFIGTADDRLLRPHAFYQ
VHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDI
GRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVMGGKK
MVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVH
VSFYVCNGKRKRSQYQRFTYLPANVPMIKTEPTDDYEPAPNCGPVSQGLSPLPRPYYSQQ
LAMPPDPSSCLVAGFPPCPQRSTLMPAAPGASPKLHDLSPAAYTKGVTSPGHCHLGLPQP
AGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSVPPSSSCPPGLEHSLCPSSPSPPLPP
AAQELTCLQPCSPACPPATGRPQHPPPTVRRDESPAAQPRLLPEACEDSSPNLAPIPVTV
KQEPEELDQLYLDDVNEIIRNDLSGTSTHS
Download sequence
Identical sequences ENSMMUP00000029747 9544.ENSMMUP00000029747 ENSMMUP00000029747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]