SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029748 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029748
Domain Number 1 Region: 668-847
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.27e-36
Family Laminin G-like module 0.0048
Further Details:      
 
Domain Number 2 Region: 452-656
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.54e-35
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 250-432
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.71e-34
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 4 Region: 1063-1244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.02e-33
Family Laminin G-like module 0.000000422
Further Details:      
 
Domain Number 5 Region: 25-184
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.7e-30
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 6 Region: 880-1051
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-20
Family Laminin G-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029748
Domain Number - Region: 211-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000297
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029748   Gene: ENSMMUG00000022595   Transcript: ENSMMUT00000031796
Sequence length 1640
Comment pep:known_by_projection chromosome:MMUL_1:14:9744666:9852001:1 gene:ENSMMUG00000022595 transcript:ENSMMUT00000031796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGSRWRLPPPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRT
NATRALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTR
DARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLL
ANLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGK
FCSEGLEPNRCPAHLTLNSEGKEEFVATFKGNEFFCYDLSHNPIQSSTDEITLAFRTLQR
NGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEALVEPVNGKFNDNAWHDVRVTRNLR
QHAGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPVSNNFMGC
LKDVVYKNNDFKLELSRLAKEGDPKMKLQGDLSFRCEDVAALDPVTFESPEAFVALPRWS
AKRTGSISLDFRTTEPNGLLLFSQGRQAGGGAGSHSSAQRADYFAMELLDGHLYLLLDMG
SGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSRSTPFLATGDSEILDLESELYLGG
LPEGGRVDLPLPPEVWTAALRAGYVGCVRDLFIDGRSRDLRGLAEAQGAVGVAPFCSRET
LKQCASAPCRNGGICREGWNRFVCDCIGTGFLGRVCEREATVLSYDGSMYMKIMLPNAMH
TEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDGGQMKLTVNLGKGPETLFAGHKLN
DNEWHTVRVVRRGKSLQLSVDNVTVEGQMAGAHTRLEFHNIETGIMTERRFISVVPSKFI
GHLSGVVSRPRPLMGFSCSTRATAMTSLSSSCTPSSTLLTPELLPCQSSQLYLFSVHCHL
LYRQKSRTLLAHKPLPSSSSSELVSQEPAPWYIHYVFDLGNGPSLMKGNSDKPVNDNQWH
NVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGF
QGCLASVDLNGRLPDLIADALHRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDC
TMTSYGGPVCNDPGTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVD
SASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVD
SWPVNERYPAGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVR
TEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQN
TDDLLVASAECPSDDEDLEECEPSTGGELILPIITEDSLDPPPVATRSPFVPPPPTFYPF
LTGVGATQDTLPPPAARRPPSGGPCQAERDDSDCEEPIEASGFASGEVFDSSLPPTDDED
FYTTFPLVTDRTTFLSPRKPAPRPNLRTDGATGAPGVLFAPSAPAPNLPAGKMNHRDPLQ
PLLENPPLGPGAPTSFEPRRPPPLRPGVTSAPGFPHLPTANPTGPGERGPPGAVEVIRES
SSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYISNSAQSNGAVVKEKA
PTAPKTPSKAKKNKDKEYYV
Download sequence
Identical sequences ENSMMUP00000029748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]