SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029796 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029796
Domain Number 1 Region: 5-326,439-471
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.37e-48
Family FAD-linked reductases, N-terminal domain 0.00037
Further Details:      
 
Domain Number 2 Region: 312-421
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.22e-22
Family L-aminoacid/polyamine oxidase 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029796   Gene: ENSMMUG00000022630   Transcript: ENSMMUT00000031845
Sequence length 477
Comment pep:known_by_projection chromosome:MMUL_1:1:139775261:139780038:1 gene:ENSMMUG00000022630 transcript:ENSMMUT00000031845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVEGSERLGGWIRSVRGPNGAIFELGPRG
IRPAGALGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSP
PFSKPLFWAGLRELTKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSVLLGLLLGAGRTPQPDSALIRQALAERWSQWSLRGGLEMLPQAL
ETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAA
PLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGILGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKELPSHCLVHLHKNCIP
QYTLGHWQKLESARQFLAAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNG
Download sequence
Identical sequences F6WU54
ENSMMUP00000029796 9544.ENSMMUP00000029796 ENSMMUP00000029796 XP_001117868.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]