SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029809 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029809
Domain Number 1 Region: 1247-1287,1318-1451
Classification Level Classification E-value
Superfamily Fibronectin type III 1.95e-33
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 2 Region: 1053-1242
Classification Level Classification E-value
Superfamily Fibronectin type III 1.61e-31
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 3 Region: 123-291
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.24e-18
Family Pentraxin (pentaxin) 0.087
Further Details:      
 
Domain Number 4 Region: 1424-1507
Classification Level Classification E-value
Superfamily Fibronectin type III 5.91e-16
Family Fibronectin type III 0.0048
Further Details:      
 
Domain Number 5 Region: 640-690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000024
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 6 Region: 846-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 794-843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000268
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 8 Region: 899-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 9 Region: 693-743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 10 Region: 746-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000809
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 11 Region: 574-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000544
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 12 Region: 1001-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 13 Region: 950-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number 14 Region: 517-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000628
Family Laminin-type module 0.046
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029809
Domain Number - Region: 338-414
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00328
Family beta-mannanase CBM 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029809   Gene: ENSMMUG00000022640   Transcript: ENSMMUT00000031859
Sequence length 1545
Comment pep:known_by_projection chromosome:MMUL_1:1:153997908:154253708:1 gene:ENSMMUG00000022640 transcript:ENSMMUT00000031859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCPVLSLGSGFLFQVIDMLIFAYFASISLADSRGLFPRLENVGAFKNVSIVPTQAVCGL
PDRSTFCHSSAAAESIQFCSQRFCIQDCPYRSSHPTYTALFSAGLSCITPDKNDLHPNSH
SNSTSFVFGNHKNCFSSPPSPRLMASFTLAVWLKPEQQGVMCVIEKTVDGQIVFKLTISE
KETMFYYRTVNGLQPPIKVMTLERILVKKWIHLSVQVHQTKISFFINGVEKDHTPFDART
LSGSITDFASGTVQIGQSLNGLEQFVGRMQDFRLYQVALTNREILEVFSGDLLRLHAQSH
CRCPGSHPRVHPLAQRYCIPNDAGDTADNRVSRLNPEAHPLSFVNDNDVGTSWVSNVFTN
VTQLNQGVTISVDLENGQYQVFYIIIQFFSPQPTEIRIQRKKENSLDWEDWQYFARNCGA
FGMKNNGDLEKPDSVNCLQLSNFTPYSRGNVTFSILTPGPNYRPGYNDFYNTPSLQEFVK
ATQIRFHFHGQYYTTETAVNFRHRYYAVDEITISGRCQCHGHADNCDTTSQPYRCLCSQE
SFTEGLHCDRCLPLYNDKPFRQGDQVHAFNCKRCQCNSHSKSCYYNVSVDPFPFEHFRGG
GGVCNDCEHNTTGRNCELCKDYFFRQVGADPSAIDVCKPCDCDKVGARNGSILCDQIGGQ
CNCKRHVSGRQCNQCQNGFYNLQELDPDGCSPCNCNTSGTVDGDITCHQNSGQCKCKANV
IGLRCDRCNFGFKFLRSFNDDGCEPCQCNLHGSVNKFCNPLSGQCECKKEAKGLQCDTCR
ENFYGLDVTNCKACDCDTAGSLPGTVCNAKTGQCICKPNVEGRQCNKCLEGHFYLRQNNS
FLCLPCNCDKAGTINGSLLCDKSTGQCPCKLGVTGLRCNQCEPHRYNLTIDNFQGCQMCE
CDSLGTLPGTICDPISGQCLCVPNRQGRRCNQCQPGFYISPGSANGCLPCSCHTAGSVHH
ICNSLTGQCVCQDASIAGQRCDQCKDRYFGFDPQTGRCQPCNCHLSGALNETCHLVTGQC
FCKQFVTGSKCDACVPSASHLDVNNLLGCSKTPFQQPPPRGQVQSSSAINLSWSPPDSPN
AHWLTYSLLRNGFEIYTTEDQYPYSVQYFLDTDLLPYTKYSYYIETTNVHGSTRSVTVTF
RTKPGVPEGNLTLSYIIPVGSDSVTLTWTTLSNQSGPIEKYILSCVPLAGGQPCVSYEGH
ETSATIWNLVPFAKYYFSVQACTSGGCLHSLPITVTTAQAPPQRLSPPKVQKISSTELHV
EWSPPMELNGIIIRYELYMRRLRSTKETTSEESRVFQSSGWLSPQSFAESANENALKPPQ
TMTTITGLEPYTKYEFRVLAVNMAGSVSSAWVSERTGESAPVFMIPPSVVPLSSYSLNIS
WEKPADNVTRGKVVGYDINMISEQSLQQSIPVVFSQLLYTAKSQELSYTVEGLKPYRIYE
FTVTVCNSVGCVTSASGAGQTLAAAPAQLRPPLVKGINSTTIHLRWFPPEELNGPSPIYQ
LERRESSLPALMTTMMKGIRFTGNGYCKFPSSTHPVNTDFTGKCV
Download sequence
Identical sequences XP_014971755.1.72884 9544.ENSMMUP00000029809 ENSMMUP00000029809 ENSMMUP00000029809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]