SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029881 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029881
Domain Number 1 Region: 156-356
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.74e-46
Family Reprolysin-like 0.00025
Further Details:      
 
Domain Number 2 Region: 371-447
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 5.77e-19
Family Blood coagulation inhibitor (disintegrin) 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029881
Domain Number - Region: 595-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family Integrin beta EGF-like domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029881   Gene: ENSMMUG00000022695   Transcript: ENSMMUT00000031937
Sequence length 776
Comment pep:known_by_projection chromosome:MMUL_1:3:129081122:129270888:-1 gene:ENSMMUG00000022695 transcript:ENSMMUT00000031937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYVERHIEHGGKTVEVKGGEHCYYQGHIR
GNPASFVALSTCHGLHGMFYDGNHTYLIEPEENDTTQEDFHFHSVYKSRLFEFPLDDLPS
EFQQVNITPPKFILKPRPKRSKRQLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHT
NTYAKSVVNMADIIYKDQLKTRIVLVAMETWATDNKFAISENPLITLREFMKYRRDFIKE
KSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLAHNIGIIS
DKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNVEEYHDFLNSGGGACLFNKPSKLL
DPPECGNGFIETGEECDCGTPAECVLEGAECCKKCTLTQDSQCSDGLCCKKCKFQPMGTV
CREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQGICFGGRCKTRDRQCKYIWGQKV
TASDKYCYEKLNIEGTEKGNCGKNKDTWIQCNKRDVLCGYLLCTNIGNIPRLGELDGEIT
STLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFNFSTCLSS
KEGTICSGNGVCSNELKCVCNRHWIGSDCNTYFPHNDDAKTGITLSGNGVAGTNIIIGII
AGTILVLALILGITAWGYKSEMSQQLPQGDYVKKPGDGDSFYSDIPPGVSTNSASSSKKR
SNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTE
Download sequence
Identical sequences ENSMMUP00000029881 ENSMMUP00000029881 9544.ENSMMUP00000029881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]