SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029895 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029895
Domain Number 1 Region: 145-282
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-25
Family Cadherin 0.00029
Further Details:      
 
Domain Number 2 Region: 262-376
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000127
Family Cadherin 0.00085
Further Details:      
 
Domain Number 3 Region: 75-157
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000271
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 383-497
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000186
Family Cadherin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029895   Gene: ENSMMUG00000022703   Transcript: ENSMMUT00000031951
Sequence length 1050
Comment pep:known_by_projection chromosome:MMUL_1:18:24238402:24270912:1 gene:ENSMMUG00000022703 transcript:ENSMMUT00000031951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWRFFRVAAVLFIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACRE
GEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVT
PFFIIYCRALNSMGQDLERPLELRVRVLDINDNPPVFSMATFVGQIEENSNANTLVMILN
ATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYSLAVRGS
DRDGGADGMSAECECNIKILDVNDNIPYMEQSSYRVDIEENTLNSNMLEIRVIDLDEEFS
ANWMAVIFFISGNEGNWFEIEMNERTNVGILKVVKPLDYEAMQNLQLSIGVRNKAEFHHS
IMSQYKLTATAITVTVLNVIEGAVFRPGSKTYVVTGNMGSNYKVGDFVATDLDTGGPSTT
VRYVMGNNPADLLAVDSRTGIITLKNKVTREQYNMLGGKYQGTILSIDDALQRTCTGTIN
IDIQNVDGDDRTNTQASTEVTNTVREESTSSTNYETSTTYAISQPVTSTVHNNEETPLFA
DNVHFGPAGIGLLIMGFLVLGLVPFLMICCDCGGAPRSAAGFEPVPECSDGAIHSWAVEG
PQPEPGVMTTIIPQIPPDNANIIECIDNSGVYTNEYGGREMQDLGGGERMTGFELTEGVK
TSGMPEICQEYSGTLRRNSMRECREGGLNMNFMESYFCQKAYAYADEDEGRPSNDCLLIY
DIEGVGSPAGSVGCCSFIGEDPDDSFLDTLGPKFKKLADISLGKEIESYPDPDPFWPPQS
TEPVCLPQETEPIVSGHPPISPHFGTTTVISESTYPSGPGVQHPKPILDPLGYGNVTVTE
SYTTSDTLKPSVHFHDNRQASNVVVTERVVGPISGTDLHGMLEMPDLRDGSNVIVTERVI
APSSSLPASLTIHHPRESSNVVVTERVIQPTSGMIGSLSMHPELTNAHNVFVTERVVSGA
GVTGISGTTGISGGIGSSGLVGTSMGAGGGALSGAGISGGGIGLSSLGGTATIGHMRSSS
DHHFNQTIGSASPSTARSRITKYSTVQYSK
Download sequence
Identical sequences ENSMMUP00000029895 ENSMMUP00000029895 9544.ENSMMUP00000029895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]