SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029945 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029945
Domain Number 1 Region: 27-240
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.87e-73
Family Proteasome subunits 0.000000074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029945   Gene: ENSMMUG00000011301   Transcript: ENSMMUT00000032003
Sequence length 244
Comment pep:known_by_projection chromosome:MMUL_1:4:32536975:32540910:-1 gene:ENSMMUG00000011301 transcript:ENSMMUT00000032003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRPLPTPVSSRCPSLEPTEFFQSLGGDGERNVQIDMAHGTTTLAFKFQHGVIVAVDSRA
SAGSYIATLRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGDRISVSAAS
KLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMD
SGYRPNLSPEEAYDLGRRAIAHATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYR
EANQ
Download sequence
Identical sequences ENSMMUP00000029945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]