SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030076 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030076
Domain Number 1 Region: 147-225
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-26
Family Nuclear receptor 0.0000223
Further Details:      
 
Domain Number 2 Region: 199-225,266-318
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000000511
Family Nuclear receptor ligand-binding domain 0.0000776
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030076   Gene: ENSMMUG00000022839   Transcript: ENSMMUT00000032147
Sequence length 323
Comment pep:known chromosome:MMUL_1:7:127248752:127306847:-1 gene:ENSMMUG00000022839 transcript:ENSMMUT00000032147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVESHHEYPAMTFYSPAVMNYSSPS
NVTNLEGGPGRQTASPNVLWPTPGHLSPLAVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNRCTSPVTSPSSKRDAHFCAVCSDFASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CASKAKRSGSHAPLVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGMRGNA
Download sequence
Identical sequences ENSMMUP00000030076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]