SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030269 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000030269
Domain Number - Region: 157-204
Classification Level Classification E-value
Superfamily SEA domain 0.00262
Family SEA domain 0.011
Further Details:      
 
Domain Number - Region: 89-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0234
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030269   Gene: ENSMMUG00000022986   Transcript: ENSMMUT00000032351
Sequence length 218
Comment pep:novel chromosome:MMUL_1:4:46844306:46854096:-1 gene:ENSMMUG00000022986 transcript:ENSMMUT00000032351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVGVLWLISFFTFTDGHGGFLGRNDGIKTKRELTVNKRKHLGPVQEYELLLQVTYRDSK
EKRDLRNFLKLLKPPLLWSHGLTIIRAKATTSCNNLNGVLQCTCEDGYTWFPPSCLDPQN
CYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYATGI
EIQLKKAYKRIQGFESVQVTQFRWSLALSPRLECSGTF
Download sequence
Identical sequences 9544.ENSMMUP00000030269 ENSMMUP00000030269 ENSMMUP00000030269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]