SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030283 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030283
Domain Number 1 Region: 73-259
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.76e-49
Family Astacin 0.00028
Further Details:      
 
Domain Number 2 Region: 430-599
Classification Level Classification E-value
Superfamily TRAF domain-like 4.58e-38
Family MATH domain 0.00087
Further Details:      
 
Domain Number 3 Region: 268-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-29
Family MAM domain 0.0051
Further Details:      
 
Domain Number 4 Region: 672-714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000891
Family EGF-type module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030283   Gene: ENSMMUG00000023000   Transcript: ENSMMUT00000032366
Sequence length 746
Comment pep:known chromosome:MMUL_1:4:46622399:46665226:1 gene:ENSMMUG00000023000 transcript:ENSMMUT00000032366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWTRSTCILSFTLFFAHIAAVSIKYLPKENVHDADFGEQKDISEINLAAGLDLFQGDIL
LQNSRNGLRDPNTRWKFPIPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGESSYI
IFQQFNGCWSEVGDQHVGQNLSIGQGCDYKAIIEHEILHALGFYHEQSRTDRDDYVNIWW
DEILSGYQHNFDTYDDSLITDLNTPYDYESLMHYQPFSFNKNASVPTITAKIPEFNSIIG
QRLDFSAIDLERLNRMYNCTTTHTLLDHCTFEKANICGMIQGTTDDTDWVHQDSAQAGEV
DHTLLGQCTGAGYFMQLSTSSGSAEEAALLESRILYPKRKQQCLQFFYKMTGSPSDRLIV
WVRRDDSTGNVRKLVKVQTFQGDDDHNWKIAHVVLKEEQKFRYLFQGTKGDPQNSTGGIY
LDDITLTETPCPTGVWTVQNFSQVLENTSKGDKLQSPRFYNSEGYGFGLTLYPHGRENSG
YLRLAFHMCSGENDAILEWPVENRQVIITILDQEPDVRNRMSSSMVFTTSKLHTSPVIND
TVIWDRPSRVGTYHTDCDCFRSIDFGWSGFISHQMLKRRSFLKNDDLIMFVDFEDITHLS
QTEVPTKGKRLSPRSLILQGQELQVSEEGSGKAMLEEVLPVSLSQGQPSRQKRSVENTGP
LEDHNWPQYFRDPCDPNPCQNDGVCVNVKGMASCRCISGPAFFYTGERCQAMQVHGSVLG
MVIGGTAGVIFLTFSIIAILSQRPRK
Download sequence
Identical sequences F6TID4 G7P4S4
XP_001103444.1.72884 XP_005552856.1.63531 ENSMMUP00000030283 9544.ENSMMUP00000030283 ENSMMUP00000030283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]