SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030300 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030300
Domain Number 1 Region: 106-168
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 8.37e-20
Family VHP, Villin headpiece domain 0.00081
Further Details:      
 
Domain Number 2 Region: 4-76
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.00000000351
Family Gelsolin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030300   Gene: ENSMMUG00000023013   Transcript: ENSMMUT00000032384
Sequence length 168
Comment pep:novel chromosome:MMUL_1:9:30935096:30940676:1 gene:ENSMMUG00000023013 transcript:ENSMMUT00000032384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPVDNHHEVYLWQGWWPIENKITGSARICPASDRKSTMETVLQYCKGKNLKKSPPKSYLI
HAGLEPLTFTNIFPNWEHREDIAEVTEMDTEVSNQITLVEDVLAKLCKTIYLLADLLARP
LPEGVDPLKLEIYLTDEDFEFALDMTRKEYNALPSWKQVNLKKTGGLF
Download sequence
Identical sequences 9544.ENSMMUP00000030300 ENSMMUP00000030300 ENSMMUP00000030300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]