SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030346 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030346
Domain Number 1 Region: 82-238
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.73e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.0000000875
Further Details:      
 
Domain Number 2 Region: 3-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.81e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030346   Gene: ENSMMUG00000023053   Transcript: ENSMMUT00000032433
Sequence length 244
Comment pep:known scaffold:MMUL_1:1099548049568:387445:390323:1 gene:ENSMMUG00000023053 transcript:ENSMMUT00000032433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLELYLNLLSQPSRAVYIFAKKNGIPFELRTVDIIKGQHRSKEFFQINSLQKVPVLKDG
DFILTESSAILIYLSCKYQTADHWYPSDLQARARVHEYLGWHADCIRGTFGVPMWVQVLG
PLIGVQVPEEKVERNRTAIDQALQWLENKFLGDRLFLAGQQVTLADLMALEELMQPVAVG
YELFKGRPRLAAWRERVEAFLGAELCQEAHSLILSILEQAAKKTLPTPPPEVYPTMLLRI
ARIP
Download sequence
Identical sequences A0A023JCN4 A0A2K6B7V5 A0A2K6Q9P7 G8F1C9
9544.ENSMMUP00000030346 ENSMMUP00000030346 ENSMMUP00000030346 NP_001244563.1.72884 NP_001276888.1.63531 XP_010368124.1.97406 XP_011766761.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]