SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030474 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030474
Domain Number 1 Region: 183-413
Classification Level Classification E-value
Superfamily Folate-binding domain 8.95e-53
Family Aminomethyltransferase folate-binding domain 0.00063
Further Details:      
 
Domain Number 2 Region: 9-90
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000000000251
Family L-aminoacid/polyamine oxidase 0.068
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000030474
Domain Number - Region: 91-174
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000104
Family FAD-linked reductases, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030474   Gene: ENSMMUG00000023147   Transcript: ENSMMUT00000032566
Sequence length 443
Comment pep:known_by_projection chromosome:MMUL_1:20:72484007:72521946:-1 gene:ENSMMUG00000023147 transcript:ENSMMUT00000032566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVFCQLCRPAIVDADGRIYIRNWQGGILSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHF
EPLLSSLLRRMPELETLEIMKLVNCPETFTPDMRCIMGESPAVQGYFVLAGMNSAGLSFG
GGAGKYLAEWMVHGYPSENVWELDLKRFGALQSSRTFLRHRVMEVMPLMYDLKVPRWDFQ
TGRQLRTSPLYDRLDAQGARWMEKHGFERPKYFVPPDKDLLALEQSKTFYKPDWFDIVES
EVKCCKEAVCVIDMSSFTKFEITSTGDQALEVLQYLFSNDLDVPVGHIVHTGMLNEGGGY
ENDCSIARLNKRSFFMISPTDQQVHCWAWLKKHMPKDSNLLLEDVTWKYTALNLIGPRAV
DVLSELSYAPMTPDHFPSLFCKEMSVGYANGIRVMSMTHTGEPGFMLYIPIEVRGHPSLL
PTTTVGCRHSRHSPALAGLESCI
Download sequence
Identical sequences ENSMMUP00000030474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]