SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030494 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030494
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.33e-28
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030494   Gene: ENSMMUG00000023167   Transcript: ENSMMUT00000032587
Sequence length 152
Comment pep:known_by_projection chromosome:MMUL_1:12:63528315:63551792:-1 gene:ENSMMUG00000023167 transcript:ENSMMUT00000032587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEA
GDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRAL
KTLAELPEEYRDFYARRMVLHIQDKAYSKNSE
Download sequence
Identical sequences A0A024R403 A0A2I3T673
GO.35110 ENSMMUP00000030494 ENSMMUP00000030494 9544.ENSMMUP00000030494 XP_009236222.1.23681 XP_012357142.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]