SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030525 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030525
Domain Number 1 Region: 84-193
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.02e-28
Family Ferredoxin domains from multidomain proteins 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030525   Gene: ENSMMUG00000023189   Transcript: ENSMMUT00000032621
Sequence length 210
Comment pep:known chromosome:MMUL_1:14:6684568:6689290:-1 gene:ENSMMUG00000023189 transcript:ENSMMUT00000032621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCLTMPTLLRALAQAAHTGPPGGRTLHSSAVAATYKYVNMQESKTDMKSVTDRAARTLL
WTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAV
CPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEE
LLYNKEKLLNNGDKWEAEIAANIQADYLYR
Download sequence
Identical sequences A0A2K6BDD4 F7EFK7 G7PP61 Q60HE3
NP_001253111.1.72884 XP_011719403.1.29376 XP_011719404.1.29376 ENSMMUP00000030525 9544.ENSMMUP00000030525 ENSMMUP00000030525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]