SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030693 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030693
Domain Number 1 Region: 197-452
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 500-759
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-39
Family YWTD domain 0.0000396
Further Details:      
 
Domain Number 3 Region: 4-142
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-28
Family YWTD domain 0.0000667
Further Details:      
 
Domain Number 4 Region: 454-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000524
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 890-928
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 152-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 7 Region: 811-851
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 852-888
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 9 Region: 769-822
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000471
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030693   Gene: ENSMMUG00000023317   Transcript: ENSMMUT00000032803
Sequence length 1178
Comment pep:known chromosome:MMUL_1:11:12475291:12623531:-1 gene:ENSMMUG00000023317 transcript:ENSMMUT00000032803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGL
ALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSI
ERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACP
IGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNR
IYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLD
GQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANG
LTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSI
ERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCG
CPAHYALNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPL
DKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEAT
NVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREV
LFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFEN
WLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCS
HICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTE
CEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCAN
GQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQ
RMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGS
SGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSY
SYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRS
QYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences ENSMMUP00000030693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]