SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030847 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030847
Domain Number 1 Region: 12-268
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-81
Family Eukaryotic proteases 0.0000000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030847   Gene: ENSMMUG00000013760   Transcript: ENSMMUT00000032966
Sequence length 269
Comment pep:known chromosome:MMUL_1:1:18200202:18276913:1 gene:ENSMMUG00000013760 transcript:ENSMMUT00000032966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITTLLLSALVAGALSCGVPTYPPSVTRVVGGEEATPNSWPWQVSLQYTSNGKWYHTCGG
SLITKNWVLTAAHCISSSRTYRVVLGQHNLYTAESGSLAVSVSKTVVHQDWNSDQVSKGY
DIALLKLANPVSLTDKIQLACLPPAGTILPNNYPCYVTGWGNLQTNRAVPDDLQQGRLLV
VDYATCSSPRSWGSTVKTNMICAGGDGVICTCNGDSGGPLNCQAADGRWEVHGIGSLTSV
LGCNYYYMPSIFTRVSNYNDWINSVIANN
Download sequence
Identical sequences ENSMMUP00000030847 ENSMMUP00000030847 9544.ENSMMUP00000030847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]