SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030856 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030856
Domain Number 1 Region: 60-163
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.04e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000409
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000030856
Domain Number - Region: 218-245
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.0753
Family Galactoside acetyltransferase-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030856   Gene: ENSMMUG00000023438   Transcript: ENSMMUT00000032976
Sequence length 338
Comment pep:known_by_projection chromosome:MMUL_1:1:34771247:34797091:1 gene:ENSMMUG00000023438 transcript:ENSMMUT00000032976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKL
KERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGG
DPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPSYKDELRIPQLTLHEICLT
PEFINKSEHKNKLSFCRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAP
RARTAGIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQ
DSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGRY
Download sequence
Identical sequences ENSMMUP00000030856 ENSMMUP00000030856 9544.ENSMMUP00000030856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]