SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030911 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030911
Domain Number 1 Region: 852-921
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.46e-21
Family TB module/8-cys domain 0.0000687
Further Details:      
 
Domain Number 2 Region: 358-420
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.76e-18
Family TB module/8-cys domain 0.00047
Further Details:      
 
Domain Number 3 Region: 736-851
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 673-772
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000282
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 912-1064
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000675
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 6 Region: 533-653
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 1073-1125
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000576
Family TB module/8-cys domain 0.0023
Further Details:      
 
Domain Number 8 Region: 306-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000289
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 9 Region: 243-282,311-330
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000353
Family TB module/8-cys domain 0.0028
Further Details:      
 
Domain Number 10 Region: 1189-1239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000265
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1162-1203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000226
Family EGF-type module 0.007
Further Details:      
 
Domain Number 12 Region: 108-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000245
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030911   Gene: ENSMMUG00000023479   Transcript: ENSMMUT00000033034
Sequence length 1244
Comment pep:known_by_projection chromosome:MMUL_1:14:8865948:8886566:1 gene:ENSMMUG00000023479 transcript:ENSMMUT00000033034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRGAPGGLAPEMRGAGAAGLLALLLLLGLGGRVEGGPAGERGAGGGGALARERFKVV
FAPVICKRTCLKGQCRDSCQQGSNMTLIGENGHSTDTLTGSGFRVVVCPLPCMNGGQCSS
RNQCLCPPDFTGRFCQVPAGGAGGGTGGSGPGLSRAGALSTGALPPLAPEGDSVASKHAI
YAVQVIADPPGPGEGPPAQHAAFLVPLGPGQISAEVQAPPPVVNVRVHHPPEASVQVHRI
ESSNAECGSNPLPGLTKQEDCCGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGADCP
QGYKRLNSTHCQDINECAMPGVCRHGDCLNNPGSYRCVCPPGHSLGPSRTQCIADKPEEK
SLCFRLVSPEHQCQHPLTTRLTRQLCCCSVGKAWGARCQRCPADGTAAFKEICPAGKGYH
ILTSHQTLTIQGESDFSLFLHPDGPPKPQQLPESPSQAPPPEDTEEERGVTTDSPVSEER
SVQQSHPTATTSPARPYPELISRPSPPTMRWFLPDLPPSRSAVEIAPTQVTETDECRLNQ
NICGHGECVPGPPDYSCHCNPGYRSHPQHRYCVDVNECEAEPCGPGRGICMNTGGSYNCH
CNRGYRLHVGAGGRSCVDLNECAKPHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVCE
GEGNPFRSKKGLLSCLPTWGLSAADVNECAEGSPCSPGWCENLPGSFRCTCAQGYAPAPD
GRSCVDVDECEAGDVCDNGICTNTPGSFQCQCLSGYHLSRDRSHCEDIDECDFPAACIGG
DCINTNGSYRCLCPQGHRLVGGRKCQDIDECTQDPGLCLPHGACKNLQGSYVCVCDEGFT
PTQDQHGCEEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPC
PVYSSAEFHSLCPDGKGYTQDNNIVNYGIPAHRDIDECMLFGAEICKEGKCVNTQPGYEC
YCKQGFYYDGNLLECVDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPE
EMDVDECQDPAACRPGRCVNLPGSYRCECRPPWVPGPAGRDCQLPESPAERAPERRDVCW
SQRGEDGMCAGPQAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSQCPTSQSESNSFWDT
SPLLLGKPRRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECR
ELNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQRRR
Download sequence
Identical sequences ENSMMUP00000030911 9544.ENSMMUP00000030911 ENSMMUP00000030911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]