SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030963 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030963
Domain Number 1 Region: 241-355
Classification Level Classification E-value
Superfamily PH domain-like 1.3e-32
Family Pleckstrin-homology domain (PH domain) 0.0000772
Further Details:      
 
Domain Number 2 Region: 498-601
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-25
Family SH2 domain 0.0000127
Further Details:      
 
Domain Number 3 Region: 2-57
Classification Level Classification E-value
Superfamily Phenylalanine zipper 4.71e-19
Family Adapter protein APS, dimerisation domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030963   Gene: ENSMMUG00000023524   Transcript: ENSMMUT00000033091
Sequence length 730
Comment pep:known_by_projection chromosome:MMUL_1:20:26974900:26983546:-1 gene:ENSMMUG00000023524 transcript:ENSMMUT00000033091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEFCESHARAAALDFARRFRLYLASHPQYAGPGAEAAFSRRFAELFLQHFEAEVARASGS
LSPPILAPLSPGAEISPHDLSLESCRVGGPLAVLGPSRSSEDLAGPLPSSVSSSSTTSSK
PKLKKRFSLRSVGRSVRGSVRGILQWRGTVDPPSSTGPLETSSGPPVLGGNSNSNSSGGA
GTIGRGLGSDGPSPGERWTHRFERLRLSRGGGALKDGAGMVQREELLSFMGAEEAAPDPA
GVGRGGGAAGPPSGGGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSSI
TDVRTTTALEMPDRENTFVVKVEGPSEYILETVDAQHVKAWVSDIQECLSPGPCPTTSPR
PMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQDLMLGPSESNDRLSQGAYGGLSDRP
SASISPSSASIAASHFDSMELLPPELPPRIPIEEGPPAGTVHPLSAPYPPLDTPETATGS
FLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLVLTGGTGSHGVFLVRQSETRRGEYVL
TFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVP
SSQRQQEPNTSHDPPQPPEPPSWTDPPQPGAEEASRAPEVAAAAAAAAKERQEKEKAGGG
GVPEELVPVVELVPVVELEEAIAPGSEAQGAGSGGDSGVPPMVQLQQSPLGGDGEEGGHP
RAINNQYSFV
Download sequence
Identical sequences 9544.ENSMMUP00000030963 ENSMMUP00000030963 ENSMMUP00000030964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]