SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031015 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031015
Domain Number 1 Region: 151-452
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.13e-81
Family Eukaryotic proteases 0.00000000507
Further Details:      
 
Domain Number 2 Region: 42-97
Classification Level Classification E-value
Superfamily GLA-domain 6.56e-20
Family GLA-domain 0.0004
Further Details:      
 
Domain Number 3 Region: 98-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family EGF-type module 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031015   Gene: ENSMMUG00000023563   Transcript: ENSMMUT00000033144
Sequence length 462
Comment pep:known chromosome:MMUL_1:13:133868684:133877983:1 gene:ENSMMUG00000023563 transcript:ENSMMUT00000033144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRLTGLLLFVATWGISSTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRPSSLERECV
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCSSLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCQPAVK
FPCGRPWRRIEKKRSHLKRRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACG
AVLIHPSWVLTAAHCMEESKKLLVRLGEYDLRRWEKWELDLDIEEVFIHPNYTKSTTDND
IALLRLAQPATLSQTIVPICLPDSGLAERELTQAGQETLVTGWGYHSSREKEAKRNRTFI
LNFIKIPVVPRNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGL
VSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEALAKSRAP
Download sequence
Identical sequences A0A2K5VQK4
ENSMMUP00000031015 9544.ENSMMUP00000031015 ENSMMUP00000031015 XP_005572935.1.63531 XP_014965338.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]