SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031087 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031087
Domain Number 1 Region: 482-785
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.59e-102
Family PDEase 0.000000665
Further Details:      
 
Domain Number 2 Region: 268-459
Classification Level Classification E-value
Superfamily GAF domain-like 6.76e-48
Family GAF domain 0.000029
Further Details:      
 
Domain Number 3 Region: 111-260
Classification Level Classification E-value
Superfamily GAF domain-like 6.54e-20
Family GAF domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031087   Gene: ENSMMUG00000023614   Transcript: ENSMMUT00000033220
Sequence length 800
Comment pep:known_by_projection chromosome:MMUL_1:4:162106797:162448136:-1 gene:ENSMMUG00000023614 transcript:ENSMMUT00000033220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAAALLFGSDMEDGPSNNASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDEFVSESVS
AETVEKWLKRKNNKSEDESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYEL
SSIIKIATKADGFALYFLGECNNSLCIFTPPGIKEGKPRLIPAGPITQGTTISAYVAKSR
KTLLVEDILGDERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSH
QEVATANLAWASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAK
NLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGE
VLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDEN
NFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTAEEWQGLMRFTLPVRLC
KEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKH
AVTVAHCMYAILQNNHALFTDLERKGLLIACLCHDLDHRGFSNTYLQKFDHPLAALYSTS
TMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMY
QTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQ
PIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLNQWEKVIRGE
ETATWISSPSVAQKTAASED
Download sequence
Identical sequences ENSMMUP00000031087 ENSMMUP00000031087 9544.ENSMMUP00000031087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]