SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031109 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031109
Domain Number 1 Region: 955-1168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-103
Family Thrombospondin C-terminal domain 0.00000000447
Further Details:      
 
Domain Number 2 Region: 25-226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-37
Family Laminin G-like module 0.0000185
Further Details:      
 
Domain Number 3 Region: 832-954
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.09e-35
Family TSP type-3 repeat 0.000000534
Further Details:      
 
Domain Number 4 Region: 764-835
Classification Level Classification E-value
Superfamily TSP type-3 repeat 7.32e-17
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 493-544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.7e-16
Family TSP-1 type 1 repeat 0.00012
Further Details:      
 
Domain Number 6 Region: 436-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000112
Family TSP-1 type 1 repeat 0.0000813
Further Details:      
 
Domain Number 7 Region: 318-376
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000921
Family VWC domain 0.0047
Further Details:      
 
Domain Number 8 Region: 691-775
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000144
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 9 Region: 382-430
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000353
Family TSP-1 type 1 repeat 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031109   Gene: ENSMMUG00000023631   Transcript: ENSMMUT00000033244
Sequence length 1170
Comment pep:known chromosome:MMUL_1:4:166132737:166163433:-1 gene:ENSMMUG00000023631 transcript:ENSMMUT00000033244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWGLVLLALWVWPSTQAGHQDKGTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNAEDLSKITRSMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLIYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSVEDILSKKGCQQGQGAEINAISEN
TETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSND
NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQITCPPATC
ASPSFVEGECCPSCLHSVDGEEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKACQGAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQER
QMCNKRSCPVDNCFSHLYFIVVRCGLWNAGSCLCGLWKVGILWSGTWHVGCSVCNVALAV
CCETWCVGNCVVTQGGLPSVLCRVRGSQPTGVGLEAAKTEKQVCEPENPCKDKTHNCHKH
AECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNCPH
LPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCPYV
HNPAQIDTDSNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVH
NPDQTDMDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDNDGQGDACDHDDDN
DGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNVPDIDDVCPENNAISETDFRNF
QMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDD
DYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRNAL
WHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYD
QTYAGGRLGLFVFSQEMVYFSDLKYECRGE
Download sequence
Identical sequences ENSMMUP00000031109 9544.ENSMMUP00000031109 ENSMMUP00000031109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]