SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031234 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031234
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 3.8e-55
Family Globins 0.000000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031234   Gene: ENSMMUG00000030981   Transcript: ENSMMUT00000033374
Sequence length 147
Comment pep:known chromosome:MMUL_1:14:68129834:68131635:1 gene:ENSMMUG00000030981 transcript:ENSMMUT00000033374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFTAEEKAAVTSLWSKMNVEETGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPK
VKAHGKKVLTSFGDAIKNMDNLKITFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFG
KEFTPEVQAAWQKLVSAVAIALAHKYH
Download sequence
Identical sequences G7NE40 G8F3D2 Q28507
9544.ENSMMUP00000031234 ENSMMUP00000031234 NP_001040612.1.72884 XP_005578957.1.63531 XP_014970522.1.72884 XP_015290870.1.63531 ENSMMUP00000031234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]