SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031309 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031309
Domain Number 1 Region: 84-381
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.6e-60
Family Nuclear receptor ligand-binding domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 13-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.99e-29
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031309   Gene: ENSMMUG00000023767   Transcript: ENSMMUT00000033452
Sequence length 385
Comment pep:known chromosome:MMUL_1:4:155690246:155713334:-1 gene:ENSMMUG00000023767 transcript:ENSMMUT00000033452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGC
PVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHF
PSAALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEV
ATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDAN
TLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTH
SGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEE
VFFKKTIGNVPITRLLSDMYKSSDI
Download sequence
Identical sequences A0A0D9RRH8 A0A2K5C706 A0A2K5JQS0 A0A2K5NF13 A0A2K5RV09 A0A2K5TWE9 A0A2K6A7H6 A0A2K6CE10 A0A2K6RQ76 A0A2K6TN09 B0CM45 B0KWH5 B6ZGT9 G1RTH4 G3RWA0 G3TBK5 H2QTI2 H9FZ41 Q9Y466
ENSMMUP00000031309 ENSNLEP00000016548 ENSGGOP00000018334 ENSLAFP00000011366 ENSP00000357982 ENSLAFP00000011366 ENSP00000357982 ENSPTRP00000031550 gi|4507537|ref|NP_003260.1| ENSPTRP00000031550 NP_001252896.1.72884 NP_003260.1.87134 NP_003260.1.92137 XP_003278973.1.23891 XP_003404357.1.64505 XP_003935987.1.74449 XP_004044535.1.27298 XP_005551582.1.63531 XP_006881231.1.29581 XP_008005604.1.81039 XP_010380794.1.97406 XP_011757171.1.29376 XP_011808222.1.43180 XP_011831331.1.47321 XP_011905796.1.92194 XP_012293908.1.9421 XP_016800523.1.37143 XP_017399221.1.71028 XP_020020138.1.5219 XP_527467.2.37143 ENSPANP00000011483 ENSMMUP00000031309 9544.ENSMMUP00000031309 9606.ENSP00000357982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]