SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031421 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031421
Domain Number 1 Region: 89-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-61
Family SPRY domain 0.0000000266
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000104
Family RING finger domain, C3HC4 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031421   Gene: ENSMMUG00000028713   Transcript: ENSMMUT00000038322
Sequence length 288
Comment pep:known chromosome:MMUL_1:19:61784808:61786182:1 gene:ENSMMUG00000028713 transcript:ENSMMUT00000038322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHFKQIIRCPVCLKDLEEPVQLKCGYVCCLQCLNALQKEPDGEGLLCRFCSVVSQKND
IKPKYKLRALVSIIKELEPKLKSILTMNPKMRKFQVDMTLDVDTANNYLIISEDLRSFRS
GDFSQNRKEQAERFDTALCVLGAPRFTSGRHYWEVDVGTSKVWDVGICKESVNRQGKIVL
SSEHGFLTVGCRKGRVFAASSMPMTPLWVGPQLHKVGIFLDLGMRSISFYNISDGCHIYT
FNKIPVSEPWRPFFAHKRGTQEDQTFLSICPLINPASASASVYSGESK
Download sequence
Identical sequences ENSMMUP00000031421 ENSMMUP00000031421 9544.ENSMMUP00000031421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]