SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031441 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031441
Domain Number 1 Region: 12-100
Classification Level Classification E-value
Superfamily DEATH domain 4.12e-21
Family Pyrin domain, PYD 0.0065
Further Details:      
 
Domain Number 2 Region: 192-366
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000132
Family Nucleotide and nucleoside kinases 0.058
Further Details:      
 
Domain Number 3 Region: 592-754
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000811
Family 28-residue LRR 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000031441
Domain Number - Region: 540-600
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0188
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031441   Gene: ENSMMUG00000005266   Transcript: ENSMMUT00000038341
Sequence length 764
Comment pep:novel chromosome:MMUL_1:19:60946284:60953722:-1 gene:ENSMMUG00000005266 transcript:ENSMMUT00000038341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRSHTWSTMTSPQLEWTLQTLLEQLNEDELKSFKSLLRALPLEDVLQKAPWSEVEEADGK
KLAEILIHTSSENWIRSATVTVLEEMNLTELCKMAKSEMLDAFKHCFGIRKHYGETIFGL
EGYLLTLLEKKKTRQSSKPGEKEGRRNSVQKQSLVWKNTFWQGDIDSFHDDVIQRNQRFI
PFLNPRTPRKLTPYTVVLHGPAGVGKTTLAKKCMLDWTDCNLSPTVRYAFYLSCKELSRM
GPCSFAELISKDWPELQDDIPHILAQAQRILFVVDGLDELKVPPGALIQDICGDWEQQKP
VPVLLGSLLKRKMLPKATLLVTTRPRALRDLQLLVQQPIYIRVEGFLEEDRRAYFLRHFG
DEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPAPTCLTSTGLFLRFL
CSQFPQGAQLRGALRALSLLAAQGLWAQMSVLHGEDLESAGVQESDLRPFLDRDILRQDG
VAKGCYSFIHLSFQQFLTALFYALEKEEEEDRDGHAWDIGDVQKLLSEEERLKNPDLIQV
GHFLFGLANEKRVKELEATFGCQMSPEIKQELLRCKASLHANKPLSMTDLKEVLCCLYES
QEEELAKVVVAPLKKISINLTNTSEMMHCSFSLKHCRDLEKVSLQIAKGVFLENYVDFEP
DIEFESWAQQDLRSLRLWTDFCSLFSSNSNLKFLEVKQSFLSDSSVRILCDHITRSTCHL
QKVEIKNVTPDTAYRDFCLAFIGKRTLTHLTLEGHIEWERTMLL
Download sequence
Identical sequences ENSMMUP00000031441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]