SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031442 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031442
Domain Number 1 Region: 545-883
Classification Level Classification E-value
Superfamily RNI-like 2.45e-47
Family 28-residue LRR 0.00032
Further Details:      
 
Domain Number 2 Region: 5-93
Classification Level Classification E-value
Superfamily DEATH domain 6.71e-21
Family Pyrin domain, PYD 0.0065
Further Details:      
 
Domain Number 3 Region: 146-319
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000193
Family Nitrogenase iron protein-like 0.095
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000031442
Domain Number - Region: 94-173
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00456
Family Nucleotide and nucleoside kinases 0.075
Further Details:      
 
Domain Number - Region: 493-553
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0228
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031442   Gene: ENSMMUG00000005266   Transcript: ENSMMUT00000038342
Sequence length 884
Comment pep:novel chromosome:MMUL_1:19:60938457:60953701:-1 gene:ENSMMUG00000005266 transcript:ENSMMUT00000038342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMTSPQLEWTLQTLLEQLNEDELKSFKSLLRALPLEDVLQKAPWSEVEEADGKKLAEILI
HTSSENWIRSATVTVLEEMNLTELCKMAKSEMLEKKKTRQSSKDQKKKKRIFEPHFWYLA
KLFSEECNHQPQLSFLNPRTPRKLTPYTVVLHGPAGVGKTTLAKKCMLDWTDCNLSPTVR
YAFYLSCKELSRMGPCSFAELISKDWPELQDDIPHILAQAQRILFVVDGLDELKVPPGAL
IQDICGDWEQQKPVPVLLGSLLKRKMLPKATLLVTTRPRALRDLQLLVQQPIYIRVEGFL
EEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPAP
TCLTSTGLFLRFLCSQFPQGAQLRGALRALSLLAAQGLWAQMSVLHGEDLESAGVQESDL
RPFLDRDILRQDGVAKGCYSFIHLSFQQFLTALFYALEKEEEEDRDGHAWDIGDVQKLLS
EEERLKNPDLIQVGHFLFGLANEKRVKELEATFGCQMSPEIKQELLRCKASLHANKPLSM
TDLKEVLCCLYESQEEELAKVVVAPLKKISINLTNTSEMMHCSFSLKHCRDLEKVSLQIA
KGVFLEKNCWAQQDLRSLRLWTDFCSLFSSNSNLKFLEVKQSFLSDSSVRILCDHITRST
CHLQKVEIKNVTPDTAYRDFCLAFIGKRTLTHLTLEGHIEWERTMLLLLCDLLRNHKCNL
QYLSLPTCWDGEANCWCLSPMVLKANQSLRHLHLSASVLLDEGAKLLYKTMTHPKHFLQM
LSLQQCSITKRGCRYLSEALQEACSLTNLDLSLNQIARGLWILCQALENPNCNLKHLRLW
SCSLMPFYCQHLGSALISNQKLETLDLGQNHLWKSGIIQLFRVL
Download sequence
Identical sequences ENSMMUP00000031442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]