SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031443 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031443
Domain Number 1 Region: 550-886
Classification Level Classification E-value
Superfamily RNI-like 6.57e-48
Family 28-residue LRR 0.00049
Further Details:      
 
Domain Number 2 Region: 150-324
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000173
Family Nucleotide and nucleoside kinases 0.064
Further Details:      
 
Domain Number 3 Region: 5-90
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000073
Family Pyrin domain, PYD 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000031443
Domain Number - Region: 498-558
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0228
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031443   Gene: ENSMMUG00000005266   Transcript: ENSMMUT00000038343
Sequence length 887
Comment pep:novel chromosome:MMUL_1:19:60938454:60953701:-1 gene:ENSMMUG00000005266 transcript:ENSMMUT00000038343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMTSPQLEWTLQTLLEQLNEDELKSFKSLLRALPLEDVLQKAPWSEVEEADGKKLAEILI
HTSSENWSMLLNTVLEETLRRNDLWSERKKKPDNLLNQDQKKKKRIFEKQSLVWKNTFWQ
GDIDSFHDDVIQRNQRFIPFLNPRTPRKLTPYTVVLHGPAGVGKTTLAKKCMLDWTDCNL
SPTVRYAFYLSCKELSRMGPCSFAELISKDWPELQDDIPHILAQAQRILFVVDGLDELKV
PPGALIQDICGDWEQQKPVPVLLGSLLKRKMLPKATLLVTTRPRALRDLQLLVQQPIYIR
VEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKG
EDPAPTCLTSTGLFLRFLCSQFPQGAQLRGALRALSLLAAQGLWAQMSVLHGEDLESAGV
QESDLRPFLDRDILRQDGVAKGCYSFIHLSFQQFLTALFYALEKEEEEDRDGHAWDIGDV
QKLLSEEERLKNPDLIQVGHFLFGLANEKRVKELEATFGCQMSPEIKQELLRCKASLHAN
KPLSMTDLKEVLCCLYESQEEELAKVVVAPLKKISINLTNTSEMMHCSFSLKHCRDLENC
KVCDSILLTIDTVWAQQDLRSLRLWTDFCSLFSSNSNLKFLEVKQSFLSDSSVRILCDHI
TRSTCHLQKVDFLHFFFFFSSFLFYMSLHNRTLTHLTLEGHIEWERTMLLLLCDLLRNHK
CNLQYLRLGGHCATSEQWVDFFYVLKANQSLRHLHLSASVLLDEGAKLLYKTMTHPKHFL
QMLSLQQCSITKRGCRYLSEALQEACSLTNLDLSLNQIARGLWILCQALENPNCNLKHLR
LWSCSLMPFYCQHLGSALISNQKLETLDLGQNHLWKSGIIQLFRVLR
Download sequence
Identical sequences ENSMMUP00000031443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]