SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031550 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031550
Domain Number 1 Region: 2-189
Classification Level Classification E-value
Superfamily TPR-like 3.32e-53
Family Tetratricopeptide repeat (TPR) 0.0000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031550   Gene: ENSMMUG00000014727   Transcript: ENSMMUT00000018408
Sequence length 191
Comment pep:known chromosome:MMUL_1:19:53824356:53851269:-1 gene:ENSMMUG00000014727 transcript:ENSMMUT00000018408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAIEIYTDMGRFTIAAKHHISIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKC
LLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLA
VQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIK
KTIQGDEEDLR
Download sequence
Identical sequences ENSMMUP00000031550 XP_011525739.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]