SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031609 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031609
Domain Number 1 Region: 384-444
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000164
Family BSTI 0.047
Further Details:      
 
Domain Number 2 Region: 779-839
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000196
Family ATI-like 0.029
Further Details:      
 
Domain Number 3 Region: 1171-1229
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000376
Family ATI-like 0.05
Further Details:      
 
Domain Number 4 Region: 1-56
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000719
Family ATI-like 0.046
Further Details:      
 
Domain Number 5 Region: 1569-1619
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000621
Family ATI-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031609   Gene: ENSMMUG00000028761   Transcript: ENSMMUT00000038509
Sequence length 1619
Comment pep:novel chromosome:MMUL_1:19:46230642:46254118:-1 gene:ENSMMUG00000028761 transcript:ENSMMUT00000038509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCPENSHYEVCGPPCPASCPSPAPPATPAVCEGPCVEGCQCDVGFVLSADRCVPLNNGCG
CWANGTYHEAGSEFWADGTCSHRCRCGPGGGSLVCTPASCGLGEVCGLLPSGQHGCQPVS
TAECQAWGDPHYVTLDGHRFDFQGNCEYLLSAPCHGPPSGAANFTVTVANEHRGSQAVSY
TRSVTLQIYNHSLTLSARWPRQLQVDGVFVALPFHLDSLLHAHLSGADVVVTTTSGLSLT
FDGDSFVRLRVPAAYAGALCGLCGNYNQDPADDLKAVDGKPAGWQVGGATGCGECVSGPC
PSQCTPEQQESFGGPDACGVISATNGSLAPCHGLVPPAQYFQGCLLDACQVQGHPGGLCP
AVAAYVAACQAAGAQLGEWRRPDFCPFQCPAHSHYKLCGDSCPVSCPSVSAPEGCESACR
EGCVCDAGFVLSGDTCVPVGQCGCLHDDRYYPLGQTFYPGPGCDSLCHCREGGLVSCQPS
SCGPHETCRPSGGSLGCVAVGSATCQASGDPHYTTFDGRRFDFMGTCVYVLAQTCGTRPG
LHQFAVLQENVAWGNGRVSVTRVITVQVGNFTLRLEQRQWKVTVNGVDMKLPVVLANGQI
RASQHGSDVVIETDFGLRVAYDLVYYVRVTIPGNYYQQMCGLCGNYNGDPKDDFQKPNGS
QAGNANDFGNSWEEAVPGSPCLPPPTCPPGSEGCDTSKCPPEQEKKYEKEEFCGLLSSPT
GPLASCHKLVDPQGPLQDCVFDLCLGGGNLSILCSNIHAYVSACQAAGGHVKPWRTETFC
PMKCPANSHYELCADTCSLGCAALSAPLQCPDGCAEGCQCDTGFLYNGEACVPIQQCGCY
HNGVYYEPEQTVLIDDCRQQCTCHVRKGVVCQEHSCKPGQVCQPSGGVLSCITKGAGATC
WLWGDPHYHSFDGRAFDFQGTCNYVLATTGCPGVNTQGLTPFTVTTKNENRGNPAVSYVR
VVTVAALGTNISIHKGEIGKVNGVLTALPVSEANGRISVTHGASKALLVADFGLQVSYDW
NWRVDVTLPSSYHGAVCGLCGNMDRNPSNDQVFPNGTLAPSIPIWGGSWRVPGWDPLCWD
VCPGSCPTCPEDKLEQYEGPGFCGPLVPGAGGPFATCHAHVPPESFFKGCVLDVCMGGGA
HDILCKALASYVAACQAAGVVIEDWRAQVGCEITCPENSHYEVCGPPCPASCPSPAPPAT
PAVCEGPCVEGCQCDAGFVLSADRCVSLNNSCGCWANGTYHEAGSEFWADGTCSHRCRCG
PGGGSLVCTPASCGRGEVCRLLPSGQHGCQPVSTAECQAWGDPHYVTLDGHRFDFQGNCE
YLLSAPCHGPPSGAANFTVTVANEHRGSQAVSYTRSVTLQIYNHSLTLSARWPRQLQVTV
DGEAVALPVAVGRVRVTAEGRNMVLQTTKGLRLLFDGDAQVLMSVPSSFRGRLCGLCGNF
NGNWSDDFVLPNGLAASSVETFGAAWRAPGSSKGCGEGCGPQGCPVCSAEETAPYESNKA
CGQLRNPQGPFATCQAVLSPSEYFRQCVYDLCAQKGDTAFLCRSLAAYTAACQAAGVAVK
PWRTDSFCPLQCPAHSHYSICTHTCQGSCAALSGLTGCTTRCFEGCECDDRFLLSQGVC
Download sequence
Identical sequences 9544.ENSMMUP00000031609 ENSMMUP00000031609 ENSMMUP00000031610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]