SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031671 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031671
Domain Number 1 Region: 61-121
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000343
Family ATI-like 0.059
Further Details:      
 
Domain Number 2 Region: 431-486
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000018
Family BSTI 0.07
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000031671
Domain Number - Region: 258-318
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0196
Family Integrin alpha N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031671   Gene: ENSMMUG00000022126   Transcript: ENSMMUT00000031127
Sequence length 591
Comment pep:novel chromosome:MMUL_1:19:41570191:41579747:1 gene:ENSMMUG00000022126 transcript:ENSMMUT00000031127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSDLRGPFAACAWALPVGPFVDSCVEELCAANGSLPVLCQALAACQATDIPVGTWHSPAF
CEPSCPENSHWETCADICRASCPQEDVSLSLTCHSRCREGCVCDTGYLLSGSTCVSLALC
GCPWQGHILHLGVQELSPNCGELCECREAGQPPHCSPQASGDREACLLCTGAWHCGVQRG
TSWVSGDPRYCTFNSAAFTAQGACRYVLSRTCRARLGVPAFTVVKVMMEAQTPGRVQVSL
GRGWDPAPEDLGPPALSLAGGQVHVYFSDSGAMLETDAGLLVSYDWRHHISVMVPTTYAG
TLCSLCGDFNGDPHDDFVPDSSLLPDPEVFALSWKDPDSPASCSTVPRCPHKREGQYQLL
AFCGLLGTHDRPFQACDELTQAQVHMEKCIHDLCMRGSRQILCEAPGSRTQQCQQHGLLA
KPWRHLVDCKLTCPRYSHYELCGFSCPSSCTEPALPDSCPTPCQDGCQCDPGSVLSGTDC
VSPIQCSCSTGGRYHPAREAFWAGEHWEQFCHREASTHAMCCSPSSCGPGQRCGTLRGIF
GCHLLSRGTCQAAGHSHIITFDGKTVESSGTCVSVFAKSCGSSCSLPFFRV
Download sequence
Identical sequences ENSMMUP00000031671 9544.ENSMMUP00000031671 ENSMMUP00000031671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]