SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031862 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031862
Domain Number 1 Region: 3862-4100
Classification Level Classification E-value
Superfamily Plakin repeat 8.28e-88
Family Plakin repeat 0.000000022
Further Details:      
 
Domain Number 2 Region: 12-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-86
Family Calponin-homology domain, CH-domain 0.000000597
Further Details:      
 
Domain Number 3 Region: 2624-2864
Classification Level Classification E-value
Superfamily Plakin repeat 1.7e-86
Family Plakin repeat 0.0000000726
Further Details:      
 
Domain Number 4 Region: 3283-3521
Classification Level Classification E-value
Superfamily Plakin repeat 1.7e-86
Family Plakin repeat 0.0000000533
Further Details:      
 
Domain Number 5 Region: 2952-3191
Classification Level Classification E-value
Superfamily Plakin repeat 2.75e-77
Family Plakin repeat 0.000000496
Further Details:      
 
Domain Number 6 Region: 3620-3857
Classification Level Classification E-value
Superfamily Plakin repeat 3.01e-77
Family Plakin repeat 0.000000737
Further Details:      
 
Domain Number 7 Region: 4173-4214,4249-4443
Classification Level Classification E-value
Superfamily Plakin repeat 1.57e-69
Family Plakin repeat 0.000000343
Further Details:      
 
Domain Number 8 Region: 253-369
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-22
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 9 Region: 1131-1316
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-19
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 10 Region: 562-697
Classification Level Classification E-value
Superfamily Spectrin repeat 4.66e-17
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 11 Region: 4120-4168
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000228
Family Plakin repeat 0.0093
Further Details:      
 
Domain Number 12 Region: 427-559
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000204
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 13 Region: 687-775
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000089
Family Spectrin repeat 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000031862
Domain Number - Region: 1021-1130
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000288
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031862   Gene: ENSMMUG00000000388   Transcript: ENSMMUT00000038783
Sequence length 4525
Comment pep:known_by_projection chromosome:MMUL_1:8:146545866:146582964:-1 gene:ENSMMUG00000000388 transcript:ENSMMUT00000038783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSRAIQHEISSLKDERDRVQKKTFTKWVNKHLIKAQRHISDLYEDLRDGHNLISLLEV
LSGDSLPREKGRMRFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIIL
HFQISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRHKP
MLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAM
PRVPDVQDGVRANELQLRWQEYRELVLLLLQWIRHHTAAFEERRFPSSFEEIEILWSQFL
KFKEMELPAKEADKNRSKGIYQSLEGAVQAGQLKVPPGYHPLDVEKEWGKLHVAILEREK
QLRSEFERLECLQRIVTKLQMEAGLCEEQLNQADTLLQSDVRLLAAGKVPQRAGEVERDL
DKADSMIRLLFNDVQTLKDGRHPQGEQMYRRVYRLHERLVAIRTEYNLRLKAGVAAPATQ
VTQVTLQSVQRRPELEDSTLRYLQDLLAWVEENQHRVDGAEWGVDLPSVEAQLGSHRGLH
QSIEEFRAKIERARSDEGQLSPATRGAYRDCLGRLDLQYAKLLNSSKARLRSLESLHSFV
AAATKELMWLNEKEEEEVGFDWSDRNTNMTAKKESYSALMRELELKEKKIKELQSAGDRL
LREDHPARPTVESFQAALQTQWSWMLQLCCCIEAHLKENAAYFQFFSDVREAEGQLQKLQ
EALRRKYSCDRSATVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAIVQLKPRHPAHP
VRSRLPLLAVCDYKQVEVTVHKGDECQLVGPAQPSHWKVLSSSGSEAAVPSVCFLVPPPN
QEAQEAVTRLEAQHQALVTLWHQLHVDMKSLLAWQSLRRDVQLIRSWSLATFRTLKPEEQ
RQALHSLELHYQAFLRDSQDAGGFGPEDRLMAEREYGSCSHHYQQLLQSLEQGAQEESRC
QRCISELKDIRLQLEACETRTVHRLRLPLDKEPARECAQRIAEQQAGAQAEVEGLGKGVA
RLSAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEKLKTISLVIHSTQGA
EEVLRAHEEQLKEAQAVPATLPELEATKASLKKLRSQAEAQQPVFDALRDELRGAQEVGE
RLQQRHGERDVEVERWRERVAQLLERWQAVLVQTDVRQRELEQLGRQLRYYRESADPLGA
WLQDARQRQEQIQAVPLANSQAVREQLRQEKALLEEIERHGEKVEECQRFAKQYINAIKD
YELQLVTYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTRYSELTTLTSQYIKFISETL
RRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAEREAKELQQRMQEEV
VRREEAAVDAQQQKRSIQEELQXXXXXXXXXXGQARQAEAAERSRLRIEEEIRVVRLQLE
ATERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVK
AEAEAAREKQRALQALEELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEVELQSKR
ASFAEKTAQLERSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEAL
RLRLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAE
GTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQELEAELAKVRA
EMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEE
DAARQRAEAERVLAEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEE
QAAQHKADIEERLAQLRKASDSELERQKGLVEDTLRQRRQVEEEILALKASFEKAAAGKA
ELELELGRIRSNAEDTLRSKEQAELEAARQRQLAAEEEQRRREAEERVQKSLAAEEEAAR
QRKAALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFAVQQKE
QELQQTLQQEQSVLDRLRSEAEAARRAAEEAEEARVQAEREAAQSRRQVEEAERLKQSAE
EQAQARAQAQAAAEKLRKEAEQEAARRAQAEQAALRQKQAADAEMEKHKKFAEQTLRQKA
QVEQELTTLRLQLEETDHQKNLLDEELQRLKAEATEAARQRSQVEEELFSVRVQMEELSK
LKARIEAENRALILRDKDNTQRFLQEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLA
QQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLAEETQ
GFQRTLEAERQRQLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTEL
ATQEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLQQEAKLLQLKSEEMQTVQQE
QLLQETQALQQSFLSEKDSLLQRERFIEQEKAKLEQLFQDEVAKAQQLREEQQRQQQQME
QERQRLVASMEEARRRQHEAEEGVRRKQEELQQLERQRRQQEELLAEENQRLREQLQRLE
EEHRAALAHSEEVTASQVAATKTLPNGRDALDGPATETEPEHSFDGLRQKVPAQRLQEAG
ILSAEELQRLAQGHTTVDELARREDVRHYLQGHSSIAGLLLKPTNEKLSVYTALQRQLLS
PGTALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYT
GQQISLFQAMQKGLIVREHGIRLLEAQIATGGIIDPVHSHRVPVDVAYRRGYFDEEMNRV
LADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGRELVYTDSEAR
DVFEKATVSAPFGKFQGKTVTIWEIINSEYFTAEQRRDLLRQFRTGRITVEKIIKIIITV
VEEQEQKGQLCFEGLRSLVPAAELLESRVIDRELYHQLQQGERSVREVAEVDAVRQALRG
ANVIAGVWLEEAGQKLSVYDALKKDLLPSDVAVALLEAQAGTGHIIDPSTSARLTVDEAV
RAGLVGPEFHEKLLSAEKAVTGYRDPYTGQSVSLFQALKKGLIPREQGLRLLDAQLSTGG
VVDPSKSHRVPLDVACARGFLDEETSRALSAPRADAKAYCDPSTGEPVTYSELQQRCRPD
QLTGLSLLPLSEKAARARQEELYSELQARETFEKTPVDVPVGGFKGRTVTVWELISSEYF
TAEQRQELLCQFRTGKVTVEKVIKILITIVEEVETLRQERLSFSGLRAPVPASELLASRV
LSRAQFEQLKDGKTTVKDLSELDSVRTLLQGSGCLAGIYLEDTKEKVSIYEAMRRGLLRP
STAALLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEQLLSAEKAVTGYRDPYSG
STISLFQAMQKGLVLRQHGIRLLEAQIATGGIIDPVHSHRVPVDVAYQRGYFNEEMNRVL
ADPSDDTKGFFDPNTHENLTYRQLLERCVEDPETGLRLLPLKGAEKAEVVETTQVYTEEE
TRRAFEETQIDIPGGGSHGGSTMSLWEVMQSDLIPEEQRAQLMADFQAGRVTKERMIIII
IEIIEKTEIIRQQGLASYDYVRRRLTAEDLYEARIISLETYNLLREGTRSLREALEAESA
WRYLYGTGCVAGVYLPGSRQTLSIYQALKKGLLSAEVARLLLEAQAATGFLLDPVKGQRL
TVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIPTEEALRLLDA
QLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLR
RCRRDDGTGQLLLPLSDARKLTFRGLRKQITVEELVRSQVMDEATALQLREGLTSIEEVT
KNLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKG
LKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRL
LEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYL
QLMERCITDPQTGLCLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGL
IDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAIAKNLIDRSALDQY
RAGTLSITEFADMLSGNASGFRSRSSSVGSSSSYPISPAVSRTQLASWSDPTEETGPVAG
ILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTGERFPVTDAVNKGLVD
KIMVDRINLAQKAFCGLKDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDM
PGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLR
LLEAAAQSSKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSY
SSSGYGRRYASGSSASVGGPESAVA
Download sequence
Identical sequences ENSMMUP00000031862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]