SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031926 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031926
Domain Number 1 Region: 44-111
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 1.44e-21
Family Anaphylotoxins (complement system) 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000031926
Domain Number - Region: 192-241
Classification Level Classification E-value
Superfamily E set domains 0.00658
Family SVA-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031926   Gene: ENSMMUG00000028911   Transcript: ENSMMUT00000038845
Sequence length 301
Comment pep:novel chromosome:MMUL_1:19:6593064:6602393:-1 gene:ENSMMUG00000028911 transcript:ENSMMUT00000038845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKDYAGVFSDAGLTFASSSGQQTAQRAELQCPQPATRRRRSVQLAEKRMDKVGQYPKELR
KCCEHGMRENPMRFSCQRRTRYITLDEACKKAFLDCCNYITELRRQHARASHLGLARSNL
DEDIIAEENIVSRSEFPESWLWKIEELKEAPKNGISTKLMNIFLKDSITTWEILAVSLSD
KEGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPA
FCSLATAKRRHQQTVTIPPKSSLSVPYVIVPLKTGQQEVEVKAAVYHFFISDGVRKSLKV
V
Download sequence
Identical sequences ENSMMUP00000031926 ENSMMUP00000031926 9544.ENSMMUP00000031926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]