SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032002 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032002
Domain Number 1 Region: 35-101
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032002   Gene: ENSMMUG00000028939   Transcript: ENSMMUT00000038918
Sequence length 128
Comment pep:known_by_projection chromosome:MMUL_1:19:1324035:1336223:-1 gene:ENSMMUG00000028939 transcript:ENSMMUT00000038918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGFAPHPAALGPPTLLAEQMSVIGSRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRA
KTNTYIKTPVRGEEPVFIVTGRKEDVEMAKREILSAAEHFSIIRATRSKAGGLPGAAQGP
PNLPGQTT
Download sequence
Identical sequences ENSMMUP00000032002 ENSMMUP00000032002 9544.ENSMMUP00000032002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]