SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032130 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032130
Domain Number 1 Region: 157-258
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000381
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 51-98
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000294
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 21-50
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000499
Family LIM domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032130   Gene: ENSMMUG00000003128   Transcript: ENSMMUT00000039048
Sequence length 304
Comment pep:known_by_projection scaffold:MMUL_1:1099214728377:35341:57419:-1 gene:ENSMMUG00000003128 transcript:ENSMMUT00000039048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVSAPCLAHSPGVGVSKQTPCSRS
LSHHCLSLLVFGVGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVS
IDPPHGPPGCGTEHAHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDL
LIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPVHTPSGEAGGSARQKPVFARTWVAL
SPSA
Download sequence
Identical sequences ENSMMUP00000032130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]