SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032138 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032138
Domain Number 1 Region: 187-383
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.91e-53
Family Reprolysin-like 0.00025
Further Details:      
 
Domain Number 2 Region: 402-478
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 6.41e-17
Family Blood coagulation inhibitor (disintegrin) 0.00044
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000032138
Domain Number - Region: 630-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0795
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032138   Gene: ENSMMUG00000029007   Transcript: ENSMMUT00000039055
Sequence length 790
Comment pep:known_by_projection chromosome:MMUL_1:8:39592737:39761191:1 gene:ENSMMUG00000029007 transcript:ENSMMUT00000039055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRLWLLLARLCGLLASRRGFQNSLLQIVIPEKIQTNTSDSSEIEYEQISYIIPIDEKPY
TVHLKQRYFLADNFMIYLYDQGSMNARSSDIQTQCYYQGNIEGYPDSMVTLSTCSGLRGI
LQFENVSYAIEPLESAVEFQHVLYKLDNEDNDIAIFSENNRSLEEHPMDDNISISEQSEP
AVPDLFPLYLEMHIVVDKALYDYWGSDSMVVTNKVIEIVGLANSMFAQFKVTIVLSSLEV
WSDENKISTVGEADELLKRFLEWKQSYLNLRPHDIAYLLIYRDYPDYVGATFPGKMCITR
YSAGVALYPKEITLEAFSVIVTQMLALSLGISYDDPKKCRCSESICIMNPEALQSNGVKT
FSSCSLRSFQNFISNVGAKCLQNKPQMQGKSPKPVCGNGRLEGSEMCDCGTEAQCGPASC
CDFRTCVLKDGAQCYRGSCCRDCQILQSGVECRPKAHPECDIAENCNGSSPECGPDITLF
NGLPCKNSKFICYDGDCHDLDARCESVFGKGSRNAPFACYEEIQSQADRFGNCGRDRNNK
YVFCGWRNLICGRLVCTYPTRKPFHQENGDVIYAFVRDSVCVTVDYKLPRTVPDPLTVKN
GSQCDVGRVCVNRQCVESRKIKATALVCSEYTCSGHGVCDSRQKCVCSPGYNPPSCQTRS
KGFPIFPKEDMDSIMERASGKTENTWLLGFSVVLPILIVTTIVVLARKHLKKWFIKEEEF
PSSESKSEGSTQTYASQSISEGSTQTYASRTRSESSGQADTSKSKSEDSTQAYTSRSKSQ
ESTQTQSSSN
Download sequence
Identical sequences ENSMMUP00000032138 9544.ENSMMUP00000032138 XP_001095172.2.72884 ENSMMUP00000032138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]