SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032193 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032193
Domain Number 1 Region: 224-333
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-37
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 360-453
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-31
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 3 Region: 181-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000189
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032193   Gene: ENSMMUG00000013031   Transcript: ENSMMUT00000039108
Sequence length 464
Comment pep:known chromosome:MMUL_1:8:22122486:22136405:1 gene:ENSMMUG00000013031 transcript:ENSMMUT00000039108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASVPTHPPPPLCHSGPPPSGRTELVLSSPHCARPRTGDPSPCPTPSHFNGVCDISCCE
VKEGPLRPAPFSCSLLVHVSVFPLVHLSSKQVMVTHAGPLGPPSSSPHSWAPLSWSCWMQ
CPFGPPCHLASQSPPPGLASSGQLLLCPGGRKPSQASTSPGASIPQPCTDPASALICSPA
DKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPN
WPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFC
GSKKPEPVLATGSRMFLRFYSDNSVQRKGFQASHGTECGGQVRADVKTKDLYSHAQFGDN
NYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSG
PPEEVYSAGDSVLVKFHSDDTITKKGFHLRYTSTKFQDTLHSRK
Download sequence
Identical sequences ENSMMUP00000032193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]