SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032274 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032274
Domain Number 1 Region: 111-241
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-26
Family Cadherin 0.0000844
Further Details:      
 
Domain Number 2 Region: 335-455
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-19
Family Cadherin 0.00075
Further Details:      
 
Domain Number 3 Region: 23-123
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000183
Family Cadherin 0.00041
Further Details:      
 
Domain Number 4 Region: 472-553
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000002
Family Cadherin 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000032274
Domain Number - Region: 224-339
Classification Level Classification E-value
Superfamily Cadherin-like 0.00186
Family Cadherin 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032274   Gene: ENSMMUG00000012100   Transcript: ENSMMUT00000039188
Sequence length 752
Comment pep:known_by_projection chromosome:MMUL_1:20:87336311:87350012:1 gene:ENSMMUG00000012100 transcript:ENSMMUT00000039188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLYPWRRAPAPSRVRRAWVIPPISVSENHKRLPYPLVQIKSDKQQLGSVIYSIQGPGVDE
EPRGVFSIDKFTGKVFLNAMLDREKTDRFRLRAFALDLGGSTLEDPTDLEIVVVDQNDNR
PAFLQEAFTGHVLEGAAPGTYVTRAEATDADDPETDNAALRFSILQQGGPELFSIDELTG
EIRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAIITLDDINDNAPEFTRVTFPGQS
PLFKIKACAWTLGFSPTTTTHNQHFNNIICAFSSCIICFFKVKKGQKESTGALDRPKALD
YESCEHYELKVLVQNEAPLQAAAPRAERSQAKVRVHVQDTNEPPVFQENPLRTSLAEGAP
PGTLVAIFSAWDPDTEQLQRLSYSKDYDPEDWLQVDAATGRIQTQRVLSPASPFLKGGWY
RAIVLAQDDAPQPRTATGTLSIEILEVNDHAPVLALPPPGSLCSEPHQGPGLLLGATDED
LPPHGAPFHFQLSPRLPELGGNWSLSQVNVSHARLRPRNQVPEGLHRLSLLLRDSGQPPQ
QREQPLNVTVCRCGQDGVCLPGASALLAGGTGLSLGALVIVLASALLLLVLVLLVALRAR
FRQQSRGKGLLHGPQDDLRDNVLNYDEQGGGEEDQDAYDISQLRHPTALSLPLGPPPLRR
DAPQSRLHPQPPRALPTSPLDIADFISDGLEAADSDPSVPPYDTALIYDYEGDGSVAGTL
SSILSSQGDEDQDYDYLRDWGPRFARLADMYG
Download sequence
Identical sequences ENSMMUP00000032274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]