SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032343 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032343
Domain Number 1 Region: 197-368
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.84e-59
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000207
Further Details:      
 
Domain Number 2 Region: 367-476
Classification Level Classification E-value
Superfamily E set domains 1.4e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032343   Gene: ENSMMUG00000018255   Transcript: ENSMMUT00000039257
Sequence length 1454
Comment pep:known chromosome:MMUL_1:20:67948377:68081237:1 gene:ENSMMUG00000018255 transcript:ENSMMUT00000039257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEKQLTSNTVQQHPSTP
KRHTVLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTE
VPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGTLE
NQKGTGVKKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTV
KLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSN
NMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNITRKDGSTLTLQTPSSPI
LCTQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDM
ELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAAAGALNVNVK
KEISSPARPCSFEEAMKAMKTTGCNLDKVNIIPNALITPLIPSSMIKSEDVTPMEVTAEK
RSSTIFKTTKTVGSTQQALENISNIAGNGSFSSPSSSHLPSENEKQQQIQPKAYNPETLT
TIQTQDISQPGTFPAVSASSQLPNSDALLQQATQFQTRETQSREVLQSDGTVVNLSQLTE
ASQQQQQSPLQEQAQTLQQQISSNIFPSPNSVSQLQNTIQQLQAGSFTGSTASGSSGSVD
LVQQVLEAQQQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQSGVSPGMFSSTEPTVHTR
PDNLLPGRAESVHPQSENTLSNQQQQQQQQQVMESSAAMVMEMQQSICQAAAQIQSELFP
STASANGNLQQSPVYQQTSHMMSALSTNEDMQMQCELFSSPPAVSGNETSTTTTQQVATP
GTTMFQTSSSGDGEETGTQAKQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSG
TQQQGNGLFQQGNEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSLFHSPN
PIVHSQTSTTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQ
EAFFAAPNSISPLQSTSNTEQQAAFQQQAPISHIQTPMLSQEQAQPPQQGLFQPQVSLGS
LPPNPMPQSQQGTMFQSQHSIVAMQSNSPSQEQQQQQQQQQQQQQQQQQGILFSNQNTMA
TMASPKQPPPNMIFNPNQNPMANQEQQNQSIFHQQSNMAPMNQEQQPMQFQSQSTVSSLQ
NPGPTQSESSQTPLFHSSPQIQLVQGSPSSQEQQVTLFLSPASMSALQTSINQQDMQQSP
LYSPQNNMPGIQGASSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQ
LLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLL
VSLQNQGNNLTGSF
Download sequence
Identical sequences ENSMMUP00000023995 ENSMMUP00000032343 XP_014981989.1.72884 XP_014981990.1.72884 XP_014981991.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]