SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032349 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032349
Domain Number 1 Region: 58-195
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-29
Family Cadherin 0.0000253
Further Details:      
 
Domain Number 2 Region: 177-289
Classification Level Classification E-value
Superfamily Cadherin-like 5e-24
Family Cadherin 0.0000212
Further Details:      
 
Domain Number 3 Region: 284-411
Classification Level Classification E-value
Superfamily Cadherin-like 5.5e-24
Family Cadherin 0.00031
Further Details:      
 
Domain Number 4 Region: 397-499
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000314
Family Cadherin 0.0000627
Further Details:      
 
Domain Number 5 Region: 6-70
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000968
Family Cadherin 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032349   Gene: ENSMMUG00000010393   Transcript: ENSMMUT00000039263
Sequence length 684
Comment pep:known chromosome:MMUL_1:20:66993419:67053515:1 gene:ENSMMUG00000010393 transcript:ENSMMUT00000039263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIV
TDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIHTYNGVVAYSIHSQEPKDP
HDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILDANDNA
PVFDPQKYESHVPENAVGHEVQRLTVTDLDAPNSPAWRATYLIVGGDDGDHFTIATHPES
NQGILTTRKGLDFEAKNQHTLYVEVTNEAPFVLKLPTSTATIVVHVEDVNEAPVFVPPSK
VVEVQEGIPTGEAVCVYTAKDPDKENQKISYRILRDPAGWLAMDPDSGQVTVAGTLDRED
ERFVRNNIYEVMVLAVDNGSPPTTGTGTLLLTLIDVNDHGPVPEPREITICNQSPESQVL
NITDKDLSPHTSPFQAQLTDDSDIYWMAEVNEKDDTVVLSLKKFLKQDTYDVHLSLSDHG
NKEQLTVIRATVCDCHGHVEKCPDPWKGGFILPVLGAVLALLLLLLVLLLLVRKKRKVKE
PLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQLHRGLEARPEVVLRNDVAPTFIPTPMYR
PRPANPDEIGNFIIENLKAANTDPTAPPYDSLLVFDYEGSGSDAASLSSLTSSTSDQDQD
YDYLNEWGSRFKKLADMYGGGDDD
Download sequence
Identical sequences ENSMMUP00000032349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]