SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032352 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032352
Domain Number 1 Region: 32-163
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.97e-51
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000123
Further Details:      
 
Domain Number 2 Region: 165-265
Classification Level Classification E-value
Superfamily E set domains 2.96e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032352   Gene: ENSMMUG00000021843   Transcript: ENSMMUT00000039266
Sequence length 611
Comment pep:known_by_projection chromosome:MMUL_1:20:66417639:66531865:1 gene:ENSMMUG00000021843 transcript:ENSMMUT00000039266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQTVVPTTSSTSNSSLARTGRRRRRPRARGLQLLGYNEKPINLQMFIGTADDRYLRPHA
FYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHIPQPNGKVLSLQIASIPVECSQRSAQELPHIEKYSINSCSVNG
GHEMIVTGSNFLPESKIIFLEKGQDGRPHWEVEGKIIREKCQGAHIVLEVPPYHNPAVTA
AVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLPVPHPAQTQRPSSDSG
HSHDSVLSAQRSLVCSIPQTYASMVTSSHLPQLQCGDESASKEQHMIPSPVVHQPFQVTP
TPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLPGLVNLGCQPLSSIPF
HSSNSGSTGHLLAHTPHSVHALPHLQSMGYHCSNTGQRSLSSPVADQISGQPSSQLQPVT
YGPSHSGSATTASPAASHPLASSPLSGPPSPQLQSMPYQSPSSGTASSPSPATRMHSGQH
STQAQSTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDREPNFATIGLQDITLD
DGKFIYDMFLK
Download sequence
Identical sequences ENSMMUP00000032352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]