SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032379 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032379
Domain Number 1 Region: 145-251
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-24
Family Cadherin 0.00017
Further Details:      
 
Domain Number 2 Region: 252-367
Classification Level Classification E-value
Superfamily Cadherin-like 3e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 368-474
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-18
Family Cadherin 0.0058
Further Details:      
 
Domain Number 4 Region: 80-152
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000228
Family Cadherin 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032379   Gene: ENSMMUG00000023525   Transcript: ENSMMUT00000039292
Sequence length 678
Comment pep:known chromosome:MMUL_1:20:64626250:64663959:1 gene:ENSMMUG00000023525 transcript:ENSMMUT00000039292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRLMMLVATSGACLGLLAAAAAAAAAGANPAQRDTPSLLPTHRRQKRDWIWNQMHIDEE
KNTSLPHHVGKIKSSVSRKNAKYLLKGEFVDKVFRVDAETGDVFAIERLDRENISEYHLT
AVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDAD
DPTVGDHASVMYQILKGKEYFAIDNSGRIVTITKSLDREKQARYEIVVEARDAQGLRGDS
GTATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILR
GDYQDAFTIETNPTHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYLSPPAGNRAQV
IINITDVDEPPIFQQPFYHFQLKENQKKPLIGTISAIDKDITPRNVKFKFTLNTENNFTL
TDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTF
CEDMAAQVGVSIQAVVAILLSILTITVIALLIFLRRRLRKQARAHGKSVPEIHEQLVTYD
EEGGGEMDTTSYDVSVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMA
AMIEVKKDEADHDGDGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPR
FKMLAELYGSDPREELLY
Download sequence
Identical sequences ENSMMUP00000032379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]