SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032380 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032380
Domain Number 1 Region: 152-260
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.00021
Further Details:      
 
Domain Number 2 Region: 262-376
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-24
Family Cadherin 0.00071
Further Details:      
 
Domain Number 3 Region: 378-481
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-23
Family Cadherin 0.0033
Further Details:      
 
Domain Number 4 Region: 67-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000017
Family Cadherin 0.0048
Further Details:      
 
Domain Number 5 Region: 482-593
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000196
Family Cadherin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032380   Gene: ENSMMUG00000005520   Transcript: ENSMMUT00000039293
Sequence length 690
Comment pep:known chromosome:MMUL_1:20:63195782:63250314:-1 gene:ENSMMUG00000005520 transcript:ENSMMUT00000039293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKENYCLQAALVCLGMLCHSQAFAPERRGHLRPSFHGHHEKGKEGQVLQRSKRGWVWNQF
FVIEEYTGPDPVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREE
RAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQ
VTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREAKEEYHVVIQAKD
MGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEAAVPGEEVGRVKAKDPDIGEN
GLVTYSIVDGDGMELFEITTDYETQEGVIKLKKPVDFETKRAYSLKVEAANVHIDPKFIS
NGPFKDTVTVKIAVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIRYS
IDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNITVFAAEIHNRHQEAKVPVAIRILD
VNDNAPKFAAPYEGFICESDQTKPLSNQPIVTISADDKDDTANGPRFIFSLPPEIIHNPN
FTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGA
LLSCNAEAYILNAGLSTGALIAILACIVILLGCPSLKEPPPREDMRLLYGFQLMLFYYVK
INRRFCLLGVFILPFLYVVATESPARLMIR
Download sequence
Identical sequences ENSMMUP00000032380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]