SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032602 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032602
Domain Number 1 Region: 2-83,117-224
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.08e-59
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032602   Gene: ENSMMUG00000000681   Transcript: ENSMMUT00000039531
Sequence length 858
Comment pep:known_by_projection chromosome:MMUL_1:7:158434214:158564856:-1 gene:ENSMMUG00000000681 transcript:ENSMMUT00000039531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLEVLSGRNLLHEYKSSSHRIFRLNNIAKALKFLEDSNVKLVSIDAAEIADGNPSLVL
GLIWNIILFFQIKELTGNLSRNSPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRK
AIKALLAWVQRKTRKYGVAVQDFAGSWRSGLAFLAVIKAIDPSLVDMKQALENSTRENLE
KAFSIAQDALHIPRLLEPEDIMVDTPDEQSIVTYVAQFLERFPELEAEDVFDSDKEVPIE
STFVRIKETPSEQESKVFVLTENGERTYTVNHESSHPPPSKVFVCDKPESMKEFRLDGVS
SRALSDSSTEFMHQIIDQVLQGGPGKTSDISEPSPESSILSSRKESGRSNSLPIKKTVHF
ETDTYRDPSCSKNLSLCFEGSPRAAKESLRQDGHVLAVEVAAEKEQKQESLKIPESSSDK
VPGDLFLAEGTINNSQSSSYNGALESTARHDEESHSLSPPGEDTVMADSFEIKVNLMTVE
ALEEGDYFEAIPLKASKFNSDLVDFASTSQAFNEVPSPHETKPDEDAEAFENHAEKRGKR
ITKSAHKKKDSPEPQGKTDKHEPHQDSGEEAEGCPSAPEETPADKKPEVHEKAKRKSTRP
HDEEEGEDDDLQGVGEELSSSPPSSRVSLETLGSHSEEGLDFKPSPPLSKVSVIPHDLFY
FPHYEVPLAAVLEAYAEDPEDLKNEEMDLEEPEGCMPDLDPREEEAGGSQSSSSSSVPGE
SLPSASDQVLCLSRGGAGTTPASEPTPPAPHEEHQQRETKENDPMDSHQSQESPNPENIA
NPLEGNVTKESISSKKKEKRKHVDHVESSLFVAPGSIQSSDDLEEDTSDHCIPSRTSHSD
SSIYIRRHTNRSSESVSM
Download sequence
Identical sequences ENSMMUP00000032602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]