SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032644 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032644
Domain Number 1 Region: 25-160
Classification Level Classification E-value
Superfamily HAD-like 4.18e-36
Family Predicted hydrolases Cof 0.000000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032644   Gene: ENSMMUG00000022714   Transcript: ENSMMUT00000039575
Sequence length 162
Comment pep:known chromosome:MMUL_1:20:8961366:8981983:1 gene:ENSMMUG00000022714 transcript:ENSMMUT00000039575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLLFRISQDFRLYDVSQINNVFWNLCHSLIPRGTFIEFRNGMLNVSPIGRSCSQEERIEF
YELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTI
YFFGDKTMPGGNDHEIFTDPRTVGYSVTAPEDTRRICEELFS
Download sequence
Identical sequences ENSMMUP00000032644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]