SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032661 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000032661
Domain Number - Region: 366-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00116
Family EGF-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032661   Gene: ENSMMUG00000011499   Transcript: ENSMMUT00000039593
Sequence length 481
Comment pep:known_by_projection chromosome:MMUL_1:20:5200865:5210200:-1 gene:ENSMMUG00000011499 transcript:ENSMMUT00000039593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASTGRWLLLRLALLGFLWEASGGLDSGASRDDDLLLPYPRARARLPRDCTRVRAGRRE
HESWPPPPATPGAGGLAVRTFVSHFRDRAVTGHLTRAVAPLLTFSVLEPGGPGGCAARRR
ATVEETARAAGCRVAQNGGFFRMNTGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVI
GYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISAR
TAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLA
SYPSDHCQDNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGHFWRGPSCGEL
DCGPSNCSQHGQCTETGCRCDAGWTGSNCSEVKQCLQPSEATLRAGELSFFTRTTWLALT
LALAFLLLLSLAANLSLLLSRAERNRRLRGDYAYHPLQEMNGELLAVEKEQPGGAHNPFK
D
Download sequence
Identical sequences F6RZ43
ENSMMUP00000032661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]