SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032732 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032732
Domain Number 1 Region: 4-103
Classification Level Classification E-value
Superfamily SH2 domain 1.05e-19
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032732   Gene: ENSMMUG00000029271   Transcript: ENSMMUT00000039667
Sequence length 121
Comment pep:known scaffold:MMUL_1:1099214769314:256:1433:1 gene:ENSMMUG00000029271 transcript:ENSMMUT00000039667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQDSDLLAQPWYSGNCDRHAVESALLRLQKDGAYTVRPSSGPHGSQPFTLAVLLCGRVFN
IPIRRLDGGRHYALGREGRNHEELFSSVATMVQHFMRHPLPLVDRHSGSRELTCLLFPTK
P
Download sequence
Identical sequences ENSMMUP00000032732 9544.ENSMMUP00000032732 ENSMMUP00000032732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]